#darkcircles Instagram Photos & Videos

darkcircles - 262.6k posts

Statistics

We looked inside some of the posts tagged with #darkcircles and here's what we found interesting.

Inside 65 Posts

Time between posts:
11 minutes
Average like
74
Average comment
2.4
Posts with video
6/65
Posts with photo
59/65

Hashtag Popularity

We have launched our “under eye cream”. The name of the product is “Geenish”. It is made up of green tea extract, vitamin b3, pomegranate extract and goodness of vitamin e. It helps you with-
•Dark circles and fights against Signs of aging
•helps you with wrinkle
•dark around eye area
•hyderates your under eyes
•removes puffy eyes

#undereyebags #eyecream #darkcircles #collagen #organicskincare #darkspots #antiaging #antiagingskincare #antiagingproducts #antiagingcream #organic #eyeremedy

We have launched our “under eye cream”. The name of the product is “Geenish”. It is made up of green tea extract, vitamin b3, pomegranate extract and goodness of vitamin e. It helps you with-
•Dark circles and fights against Signs of aging
•helps you with wrinkle
•dark around eye area
•hyderates your under eyes
•removes puffy eyes

#undereyebags #eyecream #darkcircles #collagen #organicskincare #darkspots #antiaging #antiagingskincare #antiagingproducts #antiagingcream #organic #eyeremedy
0 0 6 hours ago

Foundation Primer Mary kay❤❤
.
Sebelum apply foundation, pastikan apply dulu Primer Mary Kay.. Sebab primer mary kay ini sgt bagus utk mengekalkan make-up agar tahan lebih lama, jika pemakaian foundation dgn betol, make-up yg kita pakai akan nampak lebih licin, flawless tidak bertompok2 di muka😉
.
Kelebihan PRIMER MARY KAY:- .
🌸 Gel yg ringan dan mudah dipakai
🌸 Mengekalkan makeup dan pemakaian foundation.
🌸 Sesuai utk semua jenis kulit
🌸 Makeup nampak lebih licin dan flawless
🌸 Memberi perlindungan kepada muka
.
Love nadia 💟
017 928 5040
#dermatologist #aesthetic #marykaybeautyconsultant #marykaymalaysia #makeupmalaysia #elizabetholsen #hadiah #clearproofmk #feedback #foundation #timewise3d #ofhg #oilfreehydratinggel #oilremovermakeup #intensemoisturizingcream #eyebagsolution #eyecreams #darkcircles #jeragatdanparutjerawatpudar #timewisefirmingeyecreammarykay #Timewiserepairskincare #youthfinitymarykay #serummarykay #lumivieset #botanicalproduct #normalskin #dryskin #oilyskin #mascara #sitinurhaliza #

Foundation Primer Mary kay❤❤
.
Sebelum apply foundation, pastikan apply dulu Primer Mary Kay.. Sebab primer mary kay ini sgt bagus utk mengekalkan make-up agar tahan lebih lama, jika pemakaian foundation dgn betol, make-up yg kita pakai akan nampak lebih licin, flawless tidak bertompok2 di muka😉
.
Kelebihan PRIMER MARY KAY:- .
🌸 Gel yg ringan dan mudah dipakai
🌸 Mengekalkan makeup dan pemakaian foundation.
🌸 Sesuai utk semua jenis kulit
🌸 Makeup nampak lebih licin dan flawless
🌸 Memberi perlindungan kepada muka
.
Love nadia 💟
017 928 5040
#dermatologist #aesthetic  #marykaybeautyconsultant #marykaymalaysia #makeupmalaysia #elizabetholsen #hadiah #clearproofmk #feedback #foundation #timewise3d #ofhg #oilfreehydratinggel #oilremovermakeup #intensemoisturizingcream #eyebagsolution #eyecreams #darkcircles #jeragatdanparutjerawatpudar #timewisefirmingeyecreammarykay #Timewiserepairskincare #youthfinitymarykay #serummarykay #lumivieset #botanicalproduct #normalskin #dryskin #oilyskin #mascara #sitinurhaliza #
1 0 6 hours ago

Foundation Primer Mary kay❤❤
.
Sebelum apply foundation, pastikan apply dulu Primer Mary Kay.. Sebab primer mary kay ini sgt bagus utk mengekalkan make-up agar tahan lebih lama, jika pemakaian foundation dgn betol, make-up yg kita pakai akan nampak lebih licin, flawless tidak bertompok2 di muka😉
.
Kelebihan PRIMER MARY KAY:- .
🌸 Gel yg ringan dan mudah dipakai
🌸 Mengekalkan makeup dan pemakaian foundation.
🌸 Sesuai utk semua jenis kulit
🌸 Makeup nampak lebih licin dan flawless
🌸 Memberi perlindungan kepada muka
.
Love nadia 💟
017 928 5040
#dermatologist #aesthetic #marykaybeautyconsultant #marykaymalaysia #makeupmalaysia #elizabetholsen #hadiah #clearproofmk #feedback #foundation #timewise3d #ofhg #oilfreehydratinggel #oilremovermakeup #intensemoisturizingcream #eyebagsolution #eyecreams #darkcircles #jeragatdanparutjerawatpudar #timewisefirmingeyecreammarykay #Timewiserepairskincare #youthfinitymarykay #serummarykay #lumivieset #botanicalproduct #normalskin #dryskin #oilyskin #mascara #sitinurhaliza #

Foundation Primer Mary kay❤❤
.
Sebelum apply foundation, pastikan apply dulu Primer Mary Kay.. Sebab primer mary kay ini sgt bagus utk mengekalkan make-up agar tahan lebih lama, jika pemakaian foundation dgn betol, make-up yg kita pakai akan nampak lebih licin, flawless tidak bertompok2 di muka😉
.
Kelebihan PRIMER MARY KAY:- .
🌸 Gel yg ringan dan mudah dipakai
🌸 Mengekalkan makeup dan pemakaian foundation.
🌸 Sesuai utk semua jenis kulit
🌸 Makeup nampak lebih licin dan flawless
🌸 Memberi perlindungan kepada muka
.
Love nadia 💟
017 928 5040
#dermatologist #aesthetic  #marykaybeautyconsultant #marykaymalaysia #makeupmalaysia #elizabetholsen #hadiah #clearproofmk #feedback #foundation #timewise3d #ofhg #oilfreehydratinggel #oilremovermakeup #intensemoisturizingcream #eyebagsolution #eyecreams #darkcircles #jeragatdanparutjerawatpudar #timewisefirmingeyecreammarykay #Timewiserepairskincare #youthfinitymarykay #serummarykay #lumivieset #botanicalproduct #normalskin #dryskin #oilyskin #mascara #sitinurhaliza #
0 0 6 hours ago

"With sweet almond oil, castor oil, rosehip oil, fairtrade coffee, vitamin E and carrot seed oil, this serum will have your tired under-eyes looking refreshed and awake instantly which is a lifesaver for the party season! I've also noticed that my eyelashes are longer and stronger and I really can't think of any other reason for this except for this eye serum! And even after a solid month of use, it looks as though I've hardly touched the bottle!" - Kelly
.
Only a handful of our favourite coffee eye serums left! Have you grabbed one yet? It's also the last day to get your Christmas orders in!
.
Photo // @ourdandylife
.
.
.
.
.
#naturalskincare #organicskincare #smallbatch #nontoxic #crueltyfree #vegan #handmadeskincare #coffeelover #butfirstcoffee #coffeeeyeserum #doubleshot #eyeserum #byebyepandaeyes
#finelines #darkcircles #awake #brightening #christmasgifts #giftideas #handmadegifts #shopsmall #shoplocal #mumlife #selfcare #smallbizau #australiansmallbusiness #madeinsydney #madewithlove #stockingfillers #littlebalm

"With sweet almond oil, castor oil, rosehip oil, fairtrade coffee, vitamin E and carrot seed oil, this serum will have your tired under-eyes looking refreshed and awake instantly which is a lifesaver for the party season! I've also noticed that my eyelashes are longer and stronger and I really can't think of any other reason for this except for this eye serum! And even after a solid month of use, it looks as though I've hardly touched the bottle!" - Kelly
.
Only a handful of our favourite coffee eye serums left! Have you grabbed one yet? It's also the last day to get your Christmas orders in!
. 
Photo // @ourdandylife
.
.
.
.
.
#naturalskincare #organicskincare #smallbatch #nontoxic #crueltyfree #vegan #handmadeskincare #coffeelover #butfirstcoffee #coffeeeyeserum #doubleshot #eyeserum #byebyepandaeyes
#finelines #darkcircles #awake #brightening #christmasgifts #giftideas #handmadegifts #shopsmall #shoplocal #mumlife #selfcare #smallbizau #australiansmallbusiness #madeinsydney #madewithlove #stockingfillers #littlebalm
3 0 7 hours ago

What a nice feedback of Sailajah Triple Action Advanced Eyegel from our lovely customer.

Isn't it good dears? Grab yours now!

#sailajahtripleactionadvancedeyegel #darkcircles #puffiness #eyebags

What a nice feedback of Sailajah Triple Action Advanced Eyegel from our lovely customer.

Isn't it good dears? Grab yours now!

#sailajahtripleactionadvancedeyegel #darkcircles #puffiness #eyebags
3 0 7 hours ago

Blackhead Remover Skin Care Vacuum Suction Tool - $ 39.44 and FREE Shipping
Find Blackhead Remover Skin Care Vacuum Suction Tool only here https://auntlaura.com
Tag a friend who would love this! | Active link in BIO
#skincare #facebeauty #beautycare #facial #cleanup #brightskin #makeup #makeuptools #cosmetic #antiaging #skin #healthyskin #wrinkles #darkcircles #darkspots #blackheads #pimplepatches #spottreatment #acnecare #perfectskin #women #beautiful #beautifulskin #bridal #weddingmakeup #womensmakeup #pickoftheday #salon

Blackhead Remover Skin Care Vacuum Suction Tool - $ 39.44 and FREE Shipping
Find Blackhead Remover Skin Care Vacuum Suction Tool only here https://auntlaura.com
Tag a friend who would love this! | Active link in BIO
#skincare #facebeauty #beautycare #facial #cleanup #brightskin #makeup #makeuptools #cosmetic #antiaging #skin #healthyskin #wrinkles #darkcircles #darkspots #blackheads #pimplepatches #spottreatment #acnecare #perfectskin #women #beautiful #beautifulskin #bridal #weddingmakeup #womensmakeup #pickoftheday #salon
1 0 7 hours ago

Natural Cucumber Hydration Skin Care Scrub - $ 15.00 and FREE Shipping
Find Natural Cucumber Hydration Skin Care Scrub only here https://auntlaura.com
Tag a friend who would love this! | Active link in BIO
#skincare #facebeauty #beautycare #facial #cleanup #brightskin #makeup #makeuptools #cosmetic #antiaging #skin #healthyskin #wrinkles #darkcircles #darkspots #blackheads #pimplepatches #spottreatment #acnecare #perfectskin #women #beautiful #beautifulskin #bridal #weddingmakeup #womensmakeup #pickoftheday #salon

Natural Cucumber Hydration Skin Care Scrub - $ 15.00 and FREE Shipping
Find Natural Cucumber Hydration Skin Care Scrub only here https://auntlaura.com
Tag a friend who would love this! | Active link in BIO
#skincare #facebeauty #beautycare #facial #cleanup #brightskin #makeup #makeuptools #cosmetic #antiaging #skin #healthyskin #wrinkles #darkcircles #darkspots #blackheads #pimplepatches #spottreatment #acnecare #perfectskin #women #beautiful #beautifulskin #bridal #weddingmakeup #womensmakeup #pickoftheday #salon
0 0 7 hours ago

Coffee Face & Body Scrub Whitening Cream - $ 18.73 and FREE Shipping
Find Coffee Face & Body Scrub Whitening Cream only here https://auntlaura.com
Tag a friend who would love this! | Active link in BIO
#skincare #facebeauty #beautycare #facial #cleanup #brightskin #makeup #makeuptools #cosmetic #antiaging #skin #healthyskin #wrinkles #darkcircles #darkspots #blackheads #pimplepatches #spottreatment #acnecare #perfectskin #women #beautiful #beautifulskin #bridal #weddingmakeup #womensmakeup #pickoftheday #salon

Coffee Face & Body Scrub Whitening Cream - $ 18.73 and FREE Shipping
Find Coffee Face & Body Scrub Whitening Cream only here https://auntlaura.com
Tag a friend who would love this! | Active link in BIO
#skincare #facebeauty #beautycare #facial #cleanup #brightskin #makeup #makeuptools #cosmetic #antiaging #skin #healthyskin #wrinkles #darkcircles #darkspots #blackheads #pimplepatches #spottreatment #acnecare #perfectskin #women #beautiful #beautifulskin #bridal #weddingmakeup #womensmakeup #pickoftheday #salon
0 0 8 hours ago

Now you can't see my effing dark circles 😂😂😂 #darkcircles #darkhair #curlyhair #latinas #proudlatina #momof3

Now you can't see my effing dark circles 😂😂😂 #darkcircles #darkhair #curlyhair #latinas #proudlatina #momof3
7 1 8 hours ago

Day 9 of Christmas Swag has arrived! This look is function and fashion all rolled into one! Whether it's grabbing your #Target drive up order or wrangling the Littles Class at church, these leggings will carry you through the holidays. This fine fabric pair of elastic jolliness can be found at fine establishments like #fivebelow or #bjswholesale. These pair nicely with any tops that cover your booty, under eye circles and messy buns.
#messyhair #donthavetimetocare #heldhostagebytoddlers #inthenameofjesus #anddumdums #snowmen #leggingsrock #ifyourbootyiscovered #darkcircles #goodtimes #amazinggrice #christmasswag

Day 9 of Christmas Swag has arrived! This look is function and fashion all rolled into one! Whether it's grabbing your #Target drive up order or wrangling the Littles Class at church, these leggings will carry you through the holidays. This fine fabric pair of elastic jolliness can be found at fine establishments like #fivebelow or #bjswholesale.  These pair nicely with any tops that cover your booty, under eye circles and messy buns. 
#messyhair #donthavetimetocare #heldhostagebytoddlers #inthenameofjesus #anddumdums #snowmen #leggingsrock #ifyourbootyiscovered #darkcircles #goodtimes #amazinggrice #christmasswag
10 0 9 hours ago

Your eyes TELL a story! What are some ways to keep your eyes looking younger looking?
.
There are various things that contribute to fatigued and older looking eyes!
.
Here are a few tips and tricks to keep your eyes looking their best!
.
.
.
#eyes #crowsfeet #puffybags #darkcircles #darkcirclesundereyes
#healthyskincaretips #skincareregime
#skincaredaily
#skincareobsessed #skincaregoals
#skinconcerns
#glowingskincare
#clearskintips
#clearskincare #antiagingskincare

#over40andfabulous
#womensupportingwomen #mompreneur #womeninspiringwomen #40something
#40pluswomen
#smallbusinessowner
#womenintheir40s

Your eyes TELL a story!  What are some ways to keep your eyes looking younger looking?
.
There are various things that contribute to fatigued and older looking eyes!
.
Here are a few  tips and tricks to keep your eyes looking their best!
.
.
.
#eyes #crowsfeet  #puffybags  #darkcircles #darkcirclesundereyes 
#healthyskincaretips #skincareregime 
#skincaredaily
 #skincareobsessed #skincaregoals 
#skinconcerns
 #glowingskincare
 #clearskintips
 #clearskincare #antiagingskincare

#over40andfabulous 
#womensupportingwomen #mompreneur #womeninspiringwomen #40something
#40pluswomen
#smallbusinessowner
#womenintheir40s
6 2 9 hours ago

FORGIVE PEOPLE BY FORGETTING THEM!! ps: those dark circles are irritating 😫
.
. . .
#hairstyles #josephs #selfie #darkcircles #examsgotmelike

FORGIVE PEOPLE BY FORGETTING THEM!! ps: those dark circles are irritating 😫
.
. . . 
#hairstyles #josephs #selfie #darkcircles #examsgotmelike
71 2 10 hours ago
Shine on... despite dark circles #365daysofphotos #darkcircles #tired #shinebrightlikeadiamond
9 2 10 hours ago

Silicone Anti Wrinkle Eye Pad - 5pcs - $ 15.00 and FREE Shipping
Find Silicone Anti Wrinkle Eye Pad - 5pcs only here https://auntlaura.com
Tag a friend who would love this! | Active link in BIO
#skincare #facebeauty #beautycare #facial #cleanup #brightskin #makeup #makeuptools #cosmetic #antiaging #skin #healthyskin #wrinkles #darkcircles #darkspots #blackheads #pimplepatches #spottreatment #acnecare #perfectskin #women #beautiful #beautifulskin #bridal #weddingmakeup #womensmakeup #pickoftheday #salon

Silicone Anti Wrinkle Eye Pad - 5pcs - $ 15.00 and FREE Shipping
Find Silicone Anti Wrinkle Eye Pad - 5pcs only here https://auntlaura.com
Tag a friend who would love this! | Active link in BIO
#skincare #facebeauty #beautycare #facial #cleanup #brightskin #makeup #makeuptools #cosmetic #antiaging #skin #healthyskin #wrinkles #darkcircles #darkspots #blackheads #pimplepatches #spottreatment #acnecare #perfectskin #women #beautiful #beautifulskin #bridal #weddingmakeup #womensmakeup #pickoftheday #salon
0 0 10 hours ago

#Repost @shumailasdiary with @make_repost
・・・
♡ Review Alert ♡
Hi insta fam.
So here i'm going to review Dmgm Photo Finish Concealer & Dmgm Studio Perfection Rose Natural 441 ● INTRODUCTION
DMGM is manufactured by @dmgmcosmetics . It's a brand of UAE,
It hase complete rage of makeup products ● Dmgm studio perfection rich cream foundation rose natural ● Claims
Soft texture instantly fills in fine lines and cover skin imperfections. Long wearing. High coverage ● My Experience
Well, i had never thought i would fall in love with a local foundation, No No i am very picky with my foundations. I have Combination skin
This foundation has a creamy formula that sets into a matt finish.
It provides high coverage and works well for oily T-Zone and other dry parts of facial skin. This is very long lasting and an survive easily for up to 7 to 8 hours, it doesn't not fade noticeably. Surprisingly whatever DMGM claims is true with this foundation.
● My Opinion
.
5/5
.
● Price & Availability .
Rs 1799
Easily available at DMGM stall in big stores.
.
♡ DMGM Photo Finish Concealer ♡
.
●My Experience
The formula is very light weight and after blending turn into semi matte finish. It hide all imperfections really well for dark circles, pigmentation or other marks.
It is also very long lasting as it claims and will stay through out the day.
Overall this Concealer is a winner but the hefty price.
● Not In Favor
.
A bit pricey as compared to my other favourite concealer.
●Rate
4/5
● Price & Availability
Rs. 1499
Easily available at DMGM stalls
.
● Question your most favourite Foundation & concealer ??
.
.
.
.
#pakistanibeautybloggers #lovepurple
#bblog #bestconcealer #acne #dry #combination #darkcircles #beautygram #instabeauty #instadaily #beautytips #healthytips #instalife #instastyle #instafit #instapic #makeupphotography #photography #dmgm #youtuber #bloger #youtube #pakistaniyoutuber #pakistan #shumailasdiary #makeup #foundation #instamakeup

#Repost @shumailasdiary with @make_repost
・・・
♡ Review Alert ♡ 
Hi insta fam.
So here i'm going to review Dmgm Photo Finish Concealer & Dmgm Studio Perfection Rose Natural 441 ● INTRODUCTION 
DMGM is manufactured by @dmgmcosmetics . It's a brand of UAE,
It hase complete rage of makeup products ● Dmgm studio perfection rich cream foundation rose natural ● Claims
Soft texture instantly fills in fine lines and cover skin imperfections. Long wearing. High coverage ●  My Experience 
Well, i had never thought i would fall in love with a local foundation, No No i am very picky with my foundations. I have Combination skin 
This foundation has a creamy formula that sets into a matt finish. 
It provides high coverage and works well for oily T-Zone and other dry parts of facial skin. This is very long lasting and an survive easily for up to 7 to 8 hours, it doesn't not fade noticeably. Surprisingly whatever DMGM claims is true with this foundation.
● My Opinion
.
5/5
.
● Price & Availability .
Rs 1799
Easily available at DMGM stall in big stores.
.
♡ DMGM Photo Finish Concealer ♡
.
●My Experience 
The formula is very light weight and after blending turn into semi matte finish. It hide all imperfections really well for dark circles, pigmentation or other marks.
It is also very long lasting as it claims and will stay through out the day.
Overall this Concealer is a winner but the hefty price.
● Not In Favor
.
A bit pricey as compared to my other favourite concealer.
●Rate 
4/5
● Price & Availability 
Rs. 1499
Easily available at DMGM stalls
.
● Question  your most favourite Foundation & concealer ??
.
.
.
.
#pakistanibeautybloggers #lovepurple 
#bblog #bestconcealer #acne #dry #combination #darkcircles #beautygram #instabeauty #instadaily #beautytips #healthytips #instalife #instastyle #instafit #instapic #makeupphotography #photography #dmgm #youtuber #bloger #youtube #pakistaniyoutuber #pakistan #shumailasdiary  #makeup #foundation #instamakeup
6 0 11 hours ago

FULL MAKEUP PROCESS - Take 4 after constant video removal from @instagram because of music copy rightss! Sticking to good old bollywood nw lol 😫😪 Anyway what do you all think of this process? Did face before eyes😊
HMUA @beautybydinaa
SAREE @traditional_boutiques
SAREE SETTING @saree_settingbyrumana
MODEL @aklima17_
DISCLAIMER NO EDIT OR FILTER!!!🥰🥰
.....................................................
To book me as your makeup artist EMAIL/DM with your enquires @beautybydinaa
Beautybydinaa@hotmail.com
......................................................
For booking enquiries DM or email for more info @beautybydinaa
Www.beautybydinaa.com
Beautybydinaa@hotmail.com
....................................................
#beautybydinaa #darkcircles #orangecorrector #eyebags #nofilter #beforeandaftermakeup #lovemakeup #makeup #igtv #prettygirl #transformation #makeover #makeupvideo #makeuptutorial #beforeandafter #powerofmakeup #makeuptransformation #cutcreaseeyes #londonmua #mua #hairstlylist #flawlessmakeup #beautifull #goodcoverage #cutcreaseeyes

FULL MAKEUP PROCESS - Take 4  after constant video removal from @instagram because of music copy rightss! Sticking to good old bollywood nw lol 😫😪 Anyway what do you all think of this process? Did face before eyes😊
HMUA @beautybydinaa 
SAREE @traditional_boutiques 
SAREE SETTING @saree_settingbyrumana 
MODEL @aklima17_
DISCLAIMER NO EDIT OR FILTER!!!🥰🥰
.....................................................
To book me as your makeup artist EMAIL/DM with your enquires @beautybydinaa 
Beautybydinaa@hotmail.com
......................................................
For booking enquiries DM or email for more info @beautybydinaa
Www.beautybydinaa.com
Beautybydinaa@hotmail.com
....................................................
#beautybydinaa #darkcircles #orangecorrector #eyebags #nofilter #beforeandaftermakeup #lovemakeup #makeup #igtv #prettygirl  #transformation #makeover #makeupvideo #makeuptutorial #beforeandafter #powerofmakeup #makeuptransformation #cutcreaseeyes #londonmua #mua #hairstlylist #flawlessmakeup #beautifull #goodcoverage #cutcreaseeyes
64 12 11 hours ago

ماسكات للعين لترطيب المنطقة حول العين و تخفيف التجاعيد و الهالات السوداء حول العينين
#eyepatch #eye #darkcircles #patch #korea #korean #koreanpop #kpop #koreanmakeup #koreanfashion #koreanstyle #koreanskincareroutine #kpoper #bts #bt21 #korean #etudehouse #seoul #morocco #maroc #المغرب #الرباط #السعودية #ksa #rabat #agadir

ماسكات للعين لترطيب المنطقة حول العين  و تخفيف التجاعيد و الهالات السوداء حول العينين 
#eyepatch #eye #darkcircles #patch #korea #korean #koreanpop #kpop #koreanmakeup #koreanfashion #koreanstyle #koreanskincareroutine #kpoper #bts #bt21 #korean #etudehouse #seoul #morocco #maroc #المغرب #الرباط #السعودية #ksa #rabat #agadir
6 0 11 hours ago

Swipe Left ➡️➡️➡️
To get rid of my dark circles I use #instablur by @thebodyshop
I mix a small amount into my #foundation by @maybelline then apply another layer over the top of #maybellinedreamradiantliquid
Then I just apply the rest of my make-up on top.
Instablur suits all skin colours so it is perfect for everyone, it can also get rid of spots and other blemishes 💄
➡️➡️➡️ #instablur #thebodyshop #darkcircles #miraclemakeup #eyeshadow #foundation #maybelline #concealer #makeup #daymakeup #england #mua #animalcrueltyfreemakeup

Swipe Left ➡️➡️➡️
To get rid of my dark circles I use #instablur by @thebodyshop 
I mix a small amount into my #foundation by @maybelline then apply another layer over the top of #maybellinedreamradiantliquid 
Then I just apply the rest of my make-up on top. 
Instablur suits all skin colours so it is perfect for everyone, it can also get rid of spots and other blemishes 💄
➡️➡️➡️ #instablur #thebodyshop #darkcircles #miraclemakeup #eyeshadow #foundation #maybelline #concealer #makeup  #daymakeup #england #mua #animalcrueltyfreemakeup
0 0 12 hours ago

Anti Wrinkle Silicone Neck Pad - $ 17.00 and FREE Shipping
Find Anti Wrinkle Silicone Neck Pad only here https://auntlaura.com
Tag a friend who would love this! | Active link in BIO
#skincare #facebeauty #beautycare #facial #cleanup #brightskin #makeup #makeuptools #cosmetic #antiaging #skin #healthyskin #wrinkles #darkcircles #darkspots #blackheads #pimplepatches #spottreatment #acnecare #perfectskin #women #beautiful #beautifulskin #bridal #weddingmakeup #womensmakeup #pickoftheday #salon

Anti Wrinkle Silicone Neck Pad - $ 17.00 and FREE Shipping
Find Anti Wrinkle Silicone Neck Pad only here https://auntlaura.com
Tag a friend who would love this! | Active link in BIO
#skincare #facebeauty #beautycare #facial #cleanup #brightskin #makeup #makeuptools #cosmetic #antiaging #skin #healthyskin #wrinkles #darkcircles #darkspots #blackheads #pimplepatches #spottreatment #acnecare #perfectskin #women #beautiful #beautifulskin #bridal #weddingmakeup #womensmakeup #pickoftheday #salon
1 0 12 hours ago

AMAZING transformation. Non surgical nose job done to rotate the tip, slim the nostrils and elevate the bridge for a contoured look. This was done using dermal fillers and PDO threads. PDO threads lift the tip. This is an advanced procedure and should only be done by an experienced clinician. ☎️ Call/Text: 416-985-6266
🌎 Toronto: 588 Bloor Street West (Tuesday, Wednesday & Friday)
🌎 Vaughan: 8655 Weston Road (Thursday and Friday)
⏰ Downtime: None
😬 Pain: Injection +/- topical anesthetic #eonmedicalspa #lipsbyjoyti #dermalfillers #toronto #vaughan #restylane #dysport #botox #belotero #juvederm #darkcircles #pdothreadlift #medispa #teartrough #nonsurgicalnosejob #woodbridge #nosejob #rhinoplastybeforeandafter #pdothreadlift #pdothreads

AMAZING transformation. Non surgical nose job done to rotate the tip, slim the nostrils and elevate the bridge for a contoured look. This was done using dermal fillers and PDO threads. PDO threads lift the tip. This is an advanced procedure and should only be done by an experienced clinician. ☎️ Call/Text: 416-985-6266
🌎 Toronto: 588 Bloor Street West (Tuesday, Wednesday & Friday)
🌎 Vaughan: 8655 Weston Road (Thursday and Friday)
⏰ Downtime: None
😬 Pain: Injection +/- topical anesthetic  #eonmedicalspa #lipsbyjoyti #dermalfillers #toronto #vaughan #restylane #dysport #botox #belotero #juvederm #darkcircles #pdothreadlift #medispa #teartrough #nonsurgicalnosejob #woodbridge #nosejob #rhinoplastybeforeandafter #pdothreadlift #pdothreads
35 0 12 hours ago

"The dark spot remover" in our Christmas Gift Sets.
This set comes with Honey Face Wash Turmeric Butter and healing clay mask.
Honey face wash helps fades away any scarring while Turmeric butter removes scarring all the way and healing clay, when used once or twice a week, dark spots are removed, scarring, and dark circles.
This set is good for any one who deals with scarring or dark spots on the skin.
#darkspots #skinscarring #facewah #turmeric #turmericbutter #healingclaymask #bentoniteclay #darkcircles #giftset #christmasgiftsets #merrychristmas #naturalproducts #freeshipping

"The dark spot remover" in our Christmas Gift Sets. 
This set comes with Honey Face Wash Turmeric Butter and healing clay mask. 
Honey face wash helps fades away any scarring while Turmeric butter removes scarring all the way and healing clay, when used once or twice a week, dark spots are removed, scarring, and dark circles. 
This set is good for any one who deals with scarring or dark spots on the skin. 
#darkspots #skinscarring #facewah #turmeric #turmericbutter #healingclaymask #bentoniteclay #darkcircles #giftset #christmasgiftsets #merrychristmas #naturalproducts #freeshipping
19 0 13 hours ago

I’m feelin’ ya .... can we make it a thing? On trend for this week maybe? 🤪

I’m feelin’ ya .... can we make it a thing? On trend for this week maybe? 🤪
14 3 13 hours ago

Melasma, also known as hyperpigmentation, occurs when the skin produces more melanin, giving the skin a darker color than the surrounding areas. The visible symptoms of hyperpigmentation can range from small areas of overly darkened skin too large, more obvious hyperpigmented skin. Some forms of hyperpigmentation are more likely to affect areas of skin that face sun exposure, including the face, arms, and legs. Hyperpigmentation affects people of all skin types. Almost all skin hyperpigmentation is the result of UV exposure.⁠
If you would like to say goodbye to melasma, click the link in the bio to request an appointment. ⁠
#gadermpartners

.⁠
.⁠
.⁠
.⁠
.⁠
.⁠
#atlantadermatologists #atlantadermatology #dermatologist #hyperpigmentation #darkcircles #skincare #agespots #greatskin #skinhealth #happyyskin #instaskin #noninvasive #womeninmedicine #takecareofyourskin #dermdivas #nonsurgical #noninvasivelipo #cleanskin #skinessentials #cosmeticdermatology #lookyourbest #nodowntime #youngerskin #skinsolutions #skintherapy #skincaretreatment #dermatology #skinofcolordermatologist #beautydoctor

Melasma, also known as hyperpigmentation, occurs when the skin produces more melanin, giving the skin a darker color than the surrounding areas. The visible symptoms of hyperpigmentation can range from small areas of overly darkened skin too large, more obvious hyperpigmented skin. Some forms of hyperpigmentation are more likely to affect areas of skin that face sun exposure, including the face, arms, and legs. Hyperpigmentation affects people of all skin types. Almost all skin hyperpigmentation is the result of UV exposure.⁠
If you would like to say goodbye to melasma, click the link in the bio to request an appointment. ⁠
#gadermpartners ⁠
⁠
.⁠
.⁠
.⁠
.⁠
.⁠
.⁠
#atlantadermatologists#atlantadermatology #dermatologist#hyperpigmentation #darkcircles #skincare #agespots #greatskin #skinhealth #happyyskin #instaskin #noninvasive #womeninmedicine #takecareofyourskin #dermdivas#nonsurgical  #noninvasivelipo #cleanskin #skinessentials #cosmeticdermatology #lookyourbest #nodowntime#youngerskin#skinsolutions#skintherapy#skincaretreatment#dermatology#skinofcolordermatologist#beautydoctor ⁠
3 0 13 hours ago
Give the gift of lashes - EVERYONE wants lashes! It’s a guaranteed winner! Please MSG me before you order. *Sunday 12/15 is the LAST DAY to order for FREE guaranteed delivery by 12/24.

#rodanandfields #randf #eyecream #brighteyes #skincare #bestskincare  #eyebags #finelines #wrinkles #tiredlooking #smoothskin #lookyounger #youngerlooking #agegracefully #bestlashserum #brighteyes #darkcircles #lashserum #tiredeyes #lashextensions #fresheyes #fulllashes #besteyecream #holidayready #lusciouslashes #eyelashes #naturallashes #lashes #reallashes #nomascara #nofalsies
6 0 13 hours ago

No matter your skin color, you’re gorgeous because you’re a WOMAN ❤️ Stretch marks or scars making you feel insecure? Come see me, I can help. My method of Brazilian Stretch Mark and Scar Camouflage is guaranteed to blend into your natural skin tone and your healed result will be phenomenal ✨ for appointments please call or text 954-774-5087!

No matter your skin color, you’re gorgeous because you’re a WOMAN ❤️ Stretch marks or scars making you feel insecure? Come see me, I can help. My method of Brazilian Stretch Mark and Scar Camouflage is guaranteed to blend into your natural skin tone and your healed result will be phenomenal ✨ for appointments please call or text 954-774-5087!
61 1 14 hours ago

This picture i clicked at 2am😁😁
.
.
.
#newmommy #mommylife❤️ #justforfun #tiredyethappy #darkcircles #babyandme #selfie #selfielove

This picture i clicked at 2am😁😁
.
.
.
#newmommy#mommylife❤️ #justforfun #tiredyethappy #darkcircles #babyandme#selfie#selfielove
35 3 14 hours ago

#SelfieSaturday 🤳🏼 17 Days Post Op: Lower Blepharoplasty, Fat Transfer and Laser Resurfacing 👨🏾‍⚕️
-
Send us your selfies for a chance to be featured on Selfie Saturday or Sunday 🤩
-
#eyelidsurgery #lowereyelid #lowerblepharoplasty #eyebags #undereyebags #eyebagremoval #eyelidlift #darkcircles #lidsbylaxmeesh #nayakplasticsurgery #avanidermspa #npsads #drnayak #facialplasticsurgery #facialplasticsurgeon #selfiesunday

#SelfieSaturday 🤳🏼 17 Days Post Op: Lower Blepharoplasty, Fat Transfer and Laser Resurfacing 👨🏾‍⚕️
-
Send us your selfies for a chance to be featured on Selfie Saturday or Sunday 🤩
-
#eyelidsurgery #lowereyelid #lowerblepharoplasty #eyebags #undereyebags #eyebagremoval #eyelidlift #darkcircles #lidsbylaxmeesh #nayakplasticsurgery #avanidermspa #npsads #drnayak #facialplasticsurgery #facialplasticsurgeon #selfiesunday
152 7 14 hours ago

Before and after photos THREE WEEKS after starting a powerful topical product packed with intensive ingredients that address fine lines, puffiness, hydration and dark color of delicate under eye area. This is what medical grade skin care looks like. 🥳🙏🤩 #undereyes #darkcircles #finelinesandwrinkles #puffinessundereyes #brighten #lift #antioxidant #protein #lakecountryaesthetics @humazemd @becca_3107_salon @justfelicialashes @rejuvenizemassagetherapy @neocutis_midwest

Before and after photos THREE WEEKS after starting a powerful topical product packed with intensive ingredients that address fine lines, puffiness, hydration and dark color of delicate under eye area. This is what medical grade skin care looks like. 🥳🙏🤩 #undereyes #darkcircles #finelinesandwrinkles #puffinessundereyes #brighten #lift #antioxidant #protein #lakecountryaesthetics @humazemd @becca_3107_salon @justfelicialashes @rejuvenizemassagetherapy @neocutis_midwest
3 1 14 hours ago

NASOLABIAL FOLD AUGMENTATION
With Vollure using a cannula.

NASOLABIAL FOLD AUGMENTATION 
With Vollure using a cannula.
53 3 14 hours ago
Tear Trough Treatment to restore lost volume and reduce dark circles under the eye with dermal filler #teartroughfillers #teartrough #redensity2 #darkcircles #refreshed #rejuvenation #tiredeyes #nmcregisterednurse #nurseprescriber #nurseledclinic #stokeontrent #newcastleunderlyme #staffordshire
7 0 14 hours ago

DAY 9 🎄
HOW TO CLEANSE, CORRECT & PROTECT AROUND THE CLOCK ⏰

Give your skin the daily care it deserves with this intelligent collection of Neora’s best-selling products, which work synergistically to cleanse, correct and protect your skin. This comprehensive set includes:
💝 our refreshing Age IQ® Double-Cleansing Face Wash
💝 our transformative Age IQ® Night and Day Creams
💝 and our broad spectrum Age IQ® IllumaBoost™ Brightening & Shield – all at a savings of 45% off the retail price.

Simplify your regimen and transform your complexion with this collection of Age IQ® products, which work together as a 24-hour, age-fighting system to help cleanse, transform, moisturise and protect your skin. Each powerful product combines the best natural ingredients with the latest innovations in science for results that can’t be duplicated. 🌱
Today’s deal is a FREE box of Eye-V Hydrogels with every Holiday Gift Set 🧴 Save $55! So really, that’s TWO free gifts today! 🥳
#Neora #MerryNeora #CleanseCorrectProtect #AgeIQEyeSerum #RealResults #24HourSkincare #DarkCircles #Wrinkles #SunDamage #FreeGift #30DayMoneybackGurarantee #SkinGoals #SkinInvestment #TwoGifts

DAY 9 🎄 
HOW TO CLEANSE, CORRECT & PROTECT AROUND THE CLOCK ⏰

Give your skin the daily care it deserves with this intelligent collection of Neora’s best-selling products, which work synergistically to cleanse, correct and protect your skin. This comprehensive set includes:
💝 our refreshing Age IQ® Double-Cleansing Face Wash
💝 our transformative Age IQ® Night and Day Creams
💝 and our broad spectrum Age IQ® IllumaBoost™ Brightening & Shield – all at a savings of 45% off the retail price.

Simplify your regimen and transform your complexion with this collection of Age IQ® products, which work together as a 24-hour, age-fighting system to help cleanse, transform, moisturise and protect your skin. Each powerful product combines the best natural ingredients with the latest innovations in science for results that can’t be duplicated. 🌱 
Today’s deal is a FREE box of Eye-V Hydrogels  with every Holiday Gift Set 🧴 Save $55! So really, that’s TWO free gifts today! 🥳 
#Neora #MerryNeora #CleanseCorrectProtect #AgeIQEyeSerum #RealResults #24HourSkincare #DarkCircles #Wrinkles #SunDamage #FreeGift #30DayMoneybackGurarantee #SkinGoals #SkinInvestment #TwoGifts
0 0 14 hours ago

Such a great day/event yesterday! I got to create my own piece of Chalk Couture art with @samanthasodeman, scored myself an awesome Zyia tank from @le_anneshanle and got to help people with which products to choose for their skin and hair. I had some people use the 30 Second Miracle on their eyes and it was amazing watching it work right before our eyes! Such a fun day with amazing people. My heart is full! #chalkcouture #zyiaactive #zyiatwisttank #30SecondMiracle #darkcircles #darkcirclestreatment #finelines #eyewrinkles #eyewrinklefix #healthyhair #healthyskin

Such a great day/event yesterday! I got to create my own piece of Chalk Couture art with @samanthasodeman, scored myself an awesome Zyia tank from @le_anneshanle and got to help people with which products to choose for their skin and hair. I had some people use the 30 Second Miracle on their eyes and it was amazing watching it work right before our eyes! Such a fun day with amazing people. My heart is full! #chalkcouture #zyiaactive #zyiatwisttank #30SecondMiracle #darkcircles #darkcirclestreatment #finelines #eyewrinkles #eyewrinklefix #healthyhair #healthyskin
5 0 14 hours ago

✨The Perfect Pout is only a phone call away ✨

Get your free consult this week while spots are still available! Call 917-355-7789 to book now! .
.
.
#teartroughfillers #teartrough #fillers #restylane #juvederm #undereyefiller #undereyebags #darkcircles #injectables #nyc #newhydepark #newyork #maderoterapia #botox #aesthetic #lips #perfectpout #womancrush #gardencity #liposuction #lipfillers #2019 #prp

✨The Perfect Pout is only a phone call away ✨

Get your free consult this week while spots are still available! Call 917-355-7789 to book now! .
.
.
#teartroughfillers #teartrough #fillers #restylane #juvederm #undereyefiller #undereyebags #darkcircles #injectables #nyc #newhydepark #newyork #maderoterapia #botox #aesthetic #lips #perfectpout #womancrush #gardencity #liposuction #lipfillers #2019 #prp
14 0 14 hours ago

Mommy's eye cream dream team!👀 .
I was out way past my bedtime last night for a Christmas themed ladies night out.🎄 I actually made it to last call!! 😱 It's been a long time since that has happened but well worth all the laughs. What's not so fun is how these holiday late nights and early wake up calls are taking a toll on my eyes. So happy that I have my dream team secret weapon! Use 'em on their own twice a day or together for the best results.
.
Active bright eye cream (aka--the silver tube) tackles dark circles and puffiness while the Multifunction Eye Cream visibly reduces fine lines, wrinkles and crows feet. Wipe away those tired eyes this holiday season!🎅🤶
.
.
.
#eyecream #eyeserum #youngerlooking #darkcircles #puffyeyes #besteyecream #finelinesandwrinkles #ultimateteam #dynamicduo #nosleepformommy #latenights #earlymorning #eyebags #eyecreamtotherescue #morningmust #morningskincare #nighttimeskincare

Mommy's eye cream dream team!👀 .
I was out way past my bedtime last night for a Christmas themed ladies night out.🎄 I actually made it to last call!! 😱 It's been a long time since that has happened but well worth all the laughs. What's not so fun is  how these holiday late nights and early wake up calls are taking a toll on my eyes. So happy that I have my dream team secret weapon! Use 'em on their own twice a day or together for the best results.
.
Active bright eye cream (aka--the silver tube) tackles dark circles and puffiness while the Multifunction Eye Cream visibly reduces fine lines, wrinkles and crows feet. Wipe away those tired eyes this holiday season!🎅🤶
.
.
.
#eyecream #eyeserum #youngerlooking #darkcircles #puffyeyes #besteyecream #finelinesandwrinkles #ultimateteam #dynamicduo #nosleepformommy #latenights #earlymorning #eyebags #eyecreamtotherescue #morningmust #morningskincare #nighttimeskincare
22 1 15 hours ago

Tis the season, right?

We Mamas are working hard to finish up all the things before the holidays 🎄, and it shows up on our face!

Dark circles, puffiness, and tired-looking eyes don’t have to give away the fact that you’re not sleeping much these days!

I actually RAN OUT of my Bright Eye Complex 😲 for several weeks, and I finally got a new one. As soon as it came, I decided to put a dab under my left eye. I waited an hour and then snapped this photo. You can definitely see how it made my under-eye area less puffy and dark.
And it works over time, too. I use this stuff twice a day to make me look bright-eyed, bushy tailed, and well rested - even during the busiest time of the whole year!

Tis the season, right?

We Mamas are working hard to finish up all the things before the holidays 🎄, and it shows up on our face!

Dark circles, puffiness, and tired-looking eyes don’t have to give away the fact that you’re not sleeping much these days!

I actually RAN OUT of my Bright Eye Complex 😲 for several weeks, and I finally got a new one. As soon as it came, I decided to put a dab under my left eye. I waited an hour and then snapped this photo. You can definitely see how it made my under-eye area less puffy and dark. 
And it works over time, too. I use this stuff twice a day to make me look bright-eyed, bushy tailed, and well rested - even during the busiest time of the whole year!
1 1 15 hours ago

Egg Facial Mask For Smooth Skin - $ 15.00 and FREE Shipping
Find Egg Facial Mask For Smooth Skin only here https://auntlaura.com
Tag a friend who would love this! | Active link in BIO
#skincare #facebeauty #beautycare #facial #cleanup #brightskin #makeup #makeuptools #cosmetic #antiaging #skin #healthyskin #wrinkles #darkcircles #darkspots #blackheads #pimplepatches #spottreatment #acnecare #perfectskin #women #beautiful #beautifulskin #bridal #weddingmakeup #womensmakeup #pickoftheday #salon

Egg Facial Mask For Smooth Skin - $ 15.00 and FREE Shipping
Find Egg Facial Mask For Smooth Skin only here https://auntlaura.com
Tag a friend who would love this! | Active link in BIO
#skincare #facebeauty #beautycare #facial #cleanup #brightskin #makeup #makeuptools #cosmetic #antiaging #skin #healthyskin #wrinkles #darkcircles #darkspots #blackheads #pimplepatches #spottreatment #acnecare #perfectskin #women #beautiful #beautifulskin #bridal #weddingmakeup #womensmakeup #pickoftheday #salon
0 1 15 hours ago

The Antioxidant eye treatment is great for reducing puffiness and dark circles around the delicate eye area! #botanicalskincare #planoesthetician #planofacials #crueltyfreeskincare #kmaskinclarity #skincare #clearskin #healthyskin #darkcircles #eyemask #eyetreatment #antiagingfacials #brighteningfacial

The Antioxidant eye treatment is great for reducing puffiness and dark circles around the delicate eye area! #botanicalskincare #planoesthetician #planofacials #crueltyfreeskincare #kmaskinclarity #skincare #clearskin #healthyskin #darkcircles #eyemask #eyetreatment #antiagingfacials #brighteningfacial
10 0 15 hours ago

🙌🏻What A Difference!!!🙌🏻
📣LOOK!! Tear Trough filler has become one of our most popular treatments. WHY? Because as you can see the results are undeniable! 💯
✅Add volume under your eyes and fill in those hollow spaces eliminating dark circles while giving you a youthful more fresh face appearance.
✅Questions? Feel free to contact us! ☎️(561) 277-1672
🗣Take advantage of our Holiday Sale!!!
.
.
#4everyoung #4everyoungantiagingsolutions
#undereyefiller #undereyebags #undereyecircles #undereyehollows #facefillers #teartroughfillers #teartrough #darkcircles #darkcirclestreatment #darkcircleundereyetreatment #floridainjections #floridainjector #4everyoung #antiaging #antiagingskincare #beforeandafter #fillerbeforeandafter #bestundereyefiller #masterinjector #bestofthebest #southfloridamedspa #southfloridafillerspecialist #southfloridabotox #4everyoungjupiter #jupiterflorida #stuartflorida #abacoajupiter

🙌🏻What A Difference!!!🙌🏻
📣LOOK!! Tear Trough filler has become one of our most popular treatments. WHY? Because as you can see the results are undeniable! 💯
✅Add volume under your eyes and fill in those hollow spaces eliminating dark circles while giving you a youthful more fresh face appearance.
✅Questions? Feel free to contact us! ☎️(561) 277-1672
🗣Take advantage of our Holiday Sale!!!
.
.
#4everyoung #4everyoungantiagingsolutions 
#undereyefiller #undereyebags #undereyecircles #undereyehollows #facefillers #teartroughfillers #teartrough #darkcircles #darkcirclestreatment #darkcircleundereyetreatment #floridainjections #floridainjector #4everyoung #antiaging #antiagingskincare #beforeandafter #fillerbeforeandafter #bestundereyefiller #masterinjector #bestofthebest #southfloridamedspa #southfloridafillerspecialist #southfloridabotox #4everyoungjupiter#jupiterflorida #stuartflorida #abacoajupiter
32 1 16 hours ago

Because laundry and puke duty were not in the plan all last night...at least there’s coffee and Active Hydration Bright Eye complex - applied only to right eye. No filter, no makeup, no sleep, just real results. Are you using the right ingredients? R+F's proprietary 3D3P Molecular Matrix, phytonutrients, caffeine and illuminating brighteners means instant results for those #tiredmom(and dad)eyes - ✌️ out #darkcircles and #puffyeyes 👋

Seriously, if you were looking to get started on a great routine, or add to your current routine - an excellent eye cream is a MUST. Holla at your girl. I’ll be here...allllll dayyyy 🤢😷

Because laundry and puke duty were not in the plan all last night...at least there’s coffee and Active Hydration Bright Eye complex - applied only to right eye.  No filter, no makeup, no sleep, just real results.  Are you using the right ingredients?  R+F's proprietary 3D3P Molecular Matrix, phytonutrients, caffeine and illuminating brighteners means instant results for those #tiredmom(and dad)eyes - ✌️ out #darkcircles and #puffyeyes 👋

Seriously, if you were looking to get started on a great routine, or add to your current routine - an excellent eye cream is a MUST.  Holla at your girl.  I’ll be here...allllll dayyyy 🤢😷
10 2 16 hours ago

COUPLE SET 👨‍❤️‍👨👨‍❤️‍👨
Last pcs available in stock
1400 only
Inbox.
.
.
. . #drrashel #drrashelserum #eyeserum #darkcircles #pigmentation #eyescare #crowline #serum #healthylifestyle #skincare #skin #onlineshop #online #onlineshopping #karachi #pakistan

COUPLE SET 👨‍❤️‍👨👨‍❤️‍👨
Last pcs available in stock 
1400 only 
Inbox.
.
.
. .#drrashel #drrashelserum #eyeserum #darkcircles #pigmentation #eyescare #crowline #serum #healthylifestyle #skincare #skin #onlineshop #online #onlineshopping #karachi #pakistan
0 0 16 hours ago

I love this stuff!! 💓 eyelid lift, dark circles & fine lines almost gone on less than 60 seconds. ⌛

#eyeserum #finelines #darkcircles #Neora

I love this stuff!! 💓 eyelid lift, dark circles & fine lines almost gone on less than 60 seconds. ⌛

#eyeserum #finelines #darkcircles #Neora
0 0 16 hours ago

You know you need this around the holidays. .up late wrapping presents 🎁
.up late watching classic movies🍿
.up late with family🤯🤠
.up late late with friends🤠😘
.
.😎Basic Naturals Under Eye Restore and Renew😎 helps reduce the appearance of puffiness and dark circles with the power of Castor Oil, Sweet Almond Oil, and vitamin e. Organic and non gmo, and is super light weight and moisturizing to reduce fine lines and wrinkles. Easily glides on in stick form to reduce product waste and contamination.
.
💕 From nature with love.💕
.
.
.
. #darkcircles #holidayswithfamily #itstheholidays #holidayparty #stockingstuffers #eyeserum #rejuvenate #youngeyes #naturalskincare #skincareroutine #oilcleansing #skincarejunkie #trending #hamsa #evileye #lovetheseproducts #organicskincare #follow #nongmo #sweetalmondoil #castoroil #beeswax #vitamine #lipbalm #eyebalm #eyes

You know you need this around the holidays. .up late wrapping presents 🎁
.up late watching classic movies🍿
.up late with family🤯🤠
.up late late with friends🤠😘
.
.😎Basic Naturals Under Eye Restore and Renew😎 helps reduce the appearance of puffiness and dark circles with the power of Castor Oil, Sweet Almond Oil, and vitamin e.  Organic and non gmo, and is super light weight and moisturizing to reduce fine lines and wrinkles. Easily glides on in stick form to reduce product waste and contamination.
.
💕 From nature with love.💕
.
.
.
.#darkcircles #holidayswithfamily #itstheholidays #holidayparty #stockingstuffers #eyeserum #rejuvenate #youngeyes #naturalskincare #skincareroutine #oilcleansing #skincarejunkie #trending #hamsa #evileye #lovetheseproducts #organicskincare #follow #nongmo #sweetalmondoil #castoroil #beeswax #vitamine #lipbalm #eyebalm #eyes
13 0 16 hours ago

I do the BEST tear troughs 😍😍😍

I do the BEST tear troughs 😍😍😍
26 4 16 hours ago

Portable Handheld High Frequency Facial Machine - $ 44.06 and FREE Shipping
Find Portable Handheld High Frequency Facial Machine only here https://auntlaura.com
Tag a friend who would love this! | Active link in BIO
#skincare #facebeauty #beautycare #facial #cleanup #brightskin #makeup #makeuptools #cosmetic #antiaging #skin #healthyskin #wrinkles #darkcircles #darkspots #blackheads #pimplepatches #spottreatment #acnecare #perfectskin #women #beautiful #beautifulskin #bridal #weddingmakeup #womensmakeup #pickoftheday #salon

Portable Handheld High Frequency Facial Machine - $ 44.06 and FREE Shipping
Find Portable Handheld High Frequency Facial Machine only here https://auntlaura.com
Tag a friend who would love this! | Active link in BIO
#skincare #facebeauty #beautycare #facial #cleanup #brightskin #makeup #makeuptools #cosmetic #antiaging #skin #healthyskin #wrinkles #darkcircles #darkspots #blackheads #pimplepatches #spottreatment #acnecare #perfectskin #women #beautiful #beautifulskin #bridal #weddingmakeup #womensmakeup #pickoftheday #salon
0 0 17 hours ago

Before and after bilateral upper eyelid blepharoplasty. Thoughts? Comment ⬇️
.
.
This procedure was performed by @acplastics based out of Ann Arbor, Michigan.
.
.
This patient is a young female who is bothered by the sad and aging look her upper eyelids are giving her. She had this done under local anesthesia in the office.
.
.
.
.
.
.
.
#plasticsurgery #cosmetics #eyelidsurgery #eyelidslift #facelift #Bleph #blepharoplasty #eyelid #eyelids #eyes #darkcircles #upperbleph #lowerbleph #plastics #upperblepharoplasty #doubleeyelid #plasticsurgeon #doubleeyelidsurgery #asianeyelid #asianeyelidsurgery

Before and after bilateral upper eyelid blepharoplasty. Thoughts? Comment ⬇️
.
.
This procedure was performed by @acplastics based out of Ann Arbor, Michigan.
.
.
This patient is a young female who is bothered by the sad and aging look her upper eyelids are giving her. She had this done under local anesthesia in the office.
.
.
.
.
.
.
.
#plasticsurgery #cosmetics #eyelidsurgery #eyelidslift #facelift #Bleph #blepharoplasty #eyelid #eyelids #eyes #darkcircles #upperbleph #lowerbleph #plastics #upperblepharoplasty #doubleeyelid #plasticsurgeon #doubleeyelidsurgery #asianeyelid #asianeyelidsurgery
257 6 17 hours ago

Chamomile infused oil

Cleanses skin, calms irritated skin, soothes eczema, reduces puffy eyes, great for dark circles, helps with hyperpigmentation.
#chamomile #chamomileoil #chamomiletoner #handmadeoil #naturalproducts #chamomileleaves #eczema #puffyeyes #darkcircles

Chamomile infused oil

Cleanses skin, calms irritated skin, soothes eczema,  reduces puffy eyes, great for dark circles, helps with hyperpigmentation. 
#chamomile #chamomileoil #chamomiletoner #handmadeoil #naturalproducts #chamomileleaves #eczema #puffyeyes #darkcircles
14 0 17 hours ago

#DarkCircles

Oversleeping, extreme fatigue, or just staying up a few hours past your normal bedtime can cause dark circles to form under your eyes. ... Lack of sleep can also cause fluid to build underneath your eyes, causing them to appear puffy. As a result, the dark circles you see may actually be shadows cast by your puffy eyelids.

Consultation & Appointments: +91 7703970973, 9810317213 * Pickup & Drop Facility is available.

#Skinclinic #hairclinic #nailclinic #antiaging #dermatology #dermatologist #hairtransplant #laserhairtreatment #skintips #laserhairremoval #scartreatment #skincare #miliaremoval #skindoctor #tattoremoval #sector12faridabad #faridabad #haryana #delhi #revyveclinique #dailyskinupdates #revyve #bestskinclinic #skinspecialist #youdeservethebest #skinproblems #skinsolutions #lasertreatment #bodycontouring

#DarkCircles

Oversleeping, extreme fatigue, or just staying up a few hours past your normal bedtime can cause dark circles to form under your eyes. ... Lack of sleep can also cause fluid to build underneath your eyes, causing them to appear puffy. As a result, the dark circles you see may actually be shadows cast by your puffy eyelids.

Consultation & Appointments: +91 7703970973, 9810317213 * Pickup & Drop Facility is available.

#Skinclinic #hairclinic #nailclinic #antiaging #dermatology #dermatologist #hairtransplant #laserhairtreatment #skintips #laserhairremoval #scartreatment #skincare #miliaremoval #skindoctor #tattoremoval #sector12faridabad #faridabad #haryana #delhi #revyveclinique #dailyskinupdates #revyve #bestskinclinic #skinspecialist #youdeservethebest #skinproblems #skinsolutions #lasertreatment #bodycontouring
3 0 17 hours ago

Coffee Eye Cream + Moisturizer?? Eye creams play an important part of a night time skin regime because they moisturize, restore and hydrate the delicate under eye area overnight. This cream keeps under-eye skin soft and prevents dark circles.

Coffee and almond oil are great skin lightening ingredients and works amazing in lightening and preventing dark circles.

What can coffee do for your skin?
fight free radicals ( damage along the skin that may speed along skin aging) decrease puffiness, tighten skin reducing under eye circle. Coffee and caffeine can help our skin by smoothing puffiness and reducing dark under eye circles.

Coffee Eye Cream + Moisturizer?? Eye creams play an important part of a night time skin regime because they moisturize, restore and hydrate the delicate under eye area overnight. This cream keeps under-eye skin soft and prevents dark circles.
•
Coffee and almond oil are great skin lightening ingredients and works amazing in lightening and preventing dark circles.
•
What can coffee do for your skin?
fight free radicals ( damage along the skin that may speed along skin aging) decrease puffiness, tighten skin reducing under eye circle. Coffee and caffeine can help our skin  by smoothing puffiness and reducing dark under eye circles.
27 1 17 hours ago
It’s hard to resist a bad boy who is a good man.😛😜🤪🥳
.
.
.
.
.
@shein_in @esteelauder @lakmeindia @sheinofficial 
P.c self timer(for a change🤪)
#instagram#ig#igers#igdaily#instadaily#instapic#instahot#black#sultry#nomakeup#dead#darkcircles#idontcare#lipstick#lips#hot#thick#fit#womenempowerment#beyou#bekind
1,385 84 17 hours ago

Double tap ♥️ for more info. Did you know ❓ almond oil has amazing benefits for skin and hair. ❤️ Tag your friends 😍😻 + 👉 share the post with someone who really needs to know this info 😍
.
.
Comment below 👇 for any queries
_________________
.
Instructions
Take few drops of almond oil and massage it gently on affected area few minutes then wipe it off with wet cloth after 5 minutes .
Follow 👉 @beauty.expertt 👈 for more tips
.
.
#almondoil #almond #rashes #finelines #wrinkles #acnescars #moisturiser #makeupremover #darkcircles
Attention - patch test before use

Double tap ♥️ for more info. Did you know ❓ almond oil has amazing benefits for skin and hair. ❤️ Tag your friends 😍😻 + 👉 share the post with someone who really needs to know this info 😍
.
.
Comment below 👇 for any queries 
_________________
.
Instructions 
Take few drops of almond oil and massage it gently on affected area few minutes then wipe it off with wet cloth after 5 minutes .
Follow 👉 @beauty.expertt 👈 for more tips
.
.
#almondoil #almond #rashes #finelines #wrinkles #acnescars #moisturiser #makeupremover #darkcircles
Attention - patch test before use
1,366 0 17 hours ago

Hey guys today I am sharing this awesome eye cream by @bellavita.organic
.
.
🍁🍁PRODUCT REVIEW🍁🍁
.
So, I got my hand on this cream . Our lifestyle got so busy now days and we need to work late nights and get up early in the morning 💛💜 .
.
For that reason we get the dark circles under the eye and looks really bad. So this cream helps to remove the dark circles organically🍀😇
.
There are some benefits😍😍
✅Lighten Dark Circles
✅Hydrates & Nourishes Under-Eye Skin
✅Reduces Eye Bags & Puffiness
✅Boost Collagen & Improves Skin Elasticity
✅Reduces Fine Lines & Wrinkles (Crow's Feet)
✅Intensively Repairs Under-Eye Skin
.
"I got these products from skinorgan.com with 15% discount. Checkout their website for amazing offers on skincare products."
.
Thank you @bellavita.organic @skinorgan for sending me these cream❤🍀
.
.
.
#bellavitaorganic #skinorgan #darkcircles #productreview #productoftheday #bodylotion #bodywash# #castoroil #healthyskin #facepack #trendingchallenge #newvideo #trendyvideo #indianyoutuber #Makeuplover #Instapost #instagram #Newyoutuber #Like #Share #Subscribe #makeuplook #mjbeautyandtips #fashion #Style #Fashionblogger #youtuber #scoialblogger #indianblogger #collabrationwithbrand

Hey guys today I am sharing this awesome eye cream by @bellavita.organic
.
.
🍁🍁PRODUCT REVIEW🍁🍁
.
So, I got my hand on this cream . Our lifestyle got so busy now days and we need to work late nights and get up early in the morning 💛💜 .
.
For that reason we get the dark circles under the eye and looks really bad. So this cream helps to remove the dark circles organically🍀😇
.
There are some benefits😍😍
✅Lighten Dark Circles
✅Hydrates & Nourishes Under-Eye Skin
✅Reduces Eye Bags & Puffiness
✅Boost Collagen & Improves Skin Elasticity
✅Reduces Fine Lines & Wrinkles (Crow's Feet)
✅Intensively Repairs Under-Eye Skin
.
"I got these products from skinorgan.com with 15% discount. Checkout their website for amazing offers on skincare products."
.
Thank you @bellavita.organic @skinorgan for sending me these  cream❤🍀
.
.
.
#bellavitaorganic #skinorgan#darkcircles#productreview#productoftheday#bodylotion#bodywash##castoroil#healthyskin#facepack#trendingchallenge#newvideo#trendyvideo#indianyoutuber#Makeuplover#Instapost#instagram#Newyoutuber#Like#Share#Subscribe#makeuplook#mjbeautyandtips#fashion#Style#Fashionblogger#youtuber#scoialblogger#indianblogger#collabrationwithbrand
19 0 17 hours ago

Our eye serum is the 💥 but what when you need that extra boost our hydrogel 👀 patches will do the trick.

#tiredeyes #Neora #darkcircles #finelines #undereye

Our eye serum is the 💥 but what when you need that extra boost our hydrogel 👀 patches will do the trick.

#tiredeyes #Neora #darkcircles #finelines #undereye
2 0 17 hours ago

Top #darkcircles posts

#ad ❁ UNDER-EYE CIRCLES 👁️👁️// Nothing says holiday like a dramatic, glittery holiday eye...but nothing takes away from this look faster than dark under-eye circles, and glitter fall-off! I’ve been testing out these eye products from @StriVectin for the past few weeks, and am seriously in love with how well they primed my eyes, while treating and concealing my genetic, dark circles. If you’ve been following me for awhile, you know that my bags are literally the bane of my existence! * ✨Hyaluronic Tripeptide Gel-Cream for Eyes:

Super refreshing. It feels like you’re quenching your eyes when you put this on, and it has a subtle brightening effect. It’s ideal for hydrating your eyes, reducing the look of fine lines, and puffiness, and protecting from the visible signs of blue light. It can be worn day and night. I love how well it sits under my makeup, and absorbs right away into my skin! * ✨NEW BlurfectorTM for Eyes, Lid & Undereye Brightening Primer:
After the eye cream, I apply this primer. The brightening, and instant coverage is UNREAL. (Check out the before and after images here, and in stories!) It’s really hard for me to find coverage that blurs dark circles, not to mention helps with fine lines and wrinkles. The fact that a primer can conceal this well (you could even get away with not even wearing concealer with this on) is unbelievable to me. It goes on super soft, doesn’t get tacky or sticky, plus it helps my makeup last!  I love that I can wear it on both my lids and my under eyes, since both are darker than the rest of my face. So many other products can only be used on my lids, OR my undereyes...rarely both.
Swipe right to see the difference these products made in brightening up my eyes! They’re definitely making their way into my rotation. Full glittery eye tutorial and product details in my stories. 👆🏽 ❁ | #StriVectin #HHFBeauty

#ad ❁ UNDER-EYE CIRCLES 👁️👁️// Nothing says holiday like a dramatic, glittery holiday eye...but nothing takes away from this look faster than dark under-eye circles, and glitter fall-off! I’ve been testing out these eye products from @StriVectin for the past few weeks, and am seriously in love with how well they primed my eyes, while treating and concealing my genetic, dark circles. If you’ve been following me for awhile, you know that my bags are literally the bane of my existence! * ✨Hyaluronic Tripeptide Gel-Cream for Eyes:

Super refreshing. It feels like you’re quenching your eyes when you put this on, and it has a subtle brightening effect. It’s ideal for hydrating your eyes, reducing the look of fine lines, and puffiness, and protecting from the visible signs of blue light. It can be worn day and night. I love how well it sits under my makeup, and absorbs right away into my skin! * ✨NEW BlurfectorTM for Eyes, Lid & Undereye Brightening Primer: 
After the eye cream, I apply this primer. The brightening, and instant coverage is UNREAL. (Check out the before and after images here, and in stories!) It’s really hard for me to find coverage that blurs dark circles, not to mention helps with fine lines and wrinkles. The fact that a primer can conceal this well (you could even get away with not even wearing concealer with this on) is unbelievable to me. It goes on super soft, doesn’t get tacky or sticky, plus it helps my makeup last!  I love that I can wear it on both my lids and my under eyes, since both are darker than the rest of my face. So many other products can only be used on my lids, OR my undereyes...rarely both. 
Swipe right to see the difference these products made in brightening up my eyes! They’re definitely making their way into my rotation. Full glittery eye tutorial and product details in my stories. 👆🏽 ❁ | #StriVectin #HHFBeauty
6,734 52 13 December, 2019

Fresh, healthy skin is the secret to a flawless holiday look. You can't go wrong with our top-rated favorites: • Vitamin Enriched Face Base - to hydrate & prime
• Corrector - to neutralize under-eye discoloration
• Instant Full Cover Concealer - to brighten & cover
• Skin Long-Wear Weightless Foundation - to perfect skin for up to 16 hours
• Perfectly Defined Long-Wear Brow Pencil - to frame the eyes

#bobbibrown #skinlongwear #foundation #longwear #concealer #corrector #hydratedskin #glowy #glowingskintips #skingoals #makeupgoals #mua #darkcircles

Fresh, healthy skin is the secret to a flawless holiday look. You can't go wrong with our top-rated favorites: • Vitamin Enriched Face Base - to hydrate & prime
• Corrector - to neutralize under-eye discoloration
• Instant Full Cover Concealer - to brighten & cover
• Skin Long-Wear Weightless Foundation - to perfect skin for up to 16 hours
• Perfectly Defined Long-Wear Brow Pencil - to frame the eyes

#bobbibrown #skinlongwear #foundation #longwear #concealer #corrector #hydratedskin #glowy #glowingskintips #skingoals #makeupgoals #mua #darkcircles
7,907 39 13 December, 2019

Colder days call for more #hydration. Our signature skin routine has you covered.

1 PREP - Use Vitamin Enriched Face Base to prep & hydrate skin
2 CORRECT - Apply Corrector on #darkcircles to neutralize discoloration & then blend Instant Full Cover Concealer on top to keep #undereyes bright & crease-free
3 PERFECT - Finish with Skin Long-Wear Weightless SPF 15 for oil-free, #fullcoverage
Available @nordstrom
#bobbibrown #skinweek #skinlongwear #easymakeup #makeuptips #foundation #glowy #glowingskin #fallbeauty #winterbeauty

Colder days call for more #hydration. Our signature skin routine has you covered.

1 PREP - Use Vitamin Enriched Face Base to prep & hydrate skin 
2 CORRECT - Apply Corrector on #darkcircles to neutralize discoloration & then blend Instant Full Cover Concealer on top to keep #undereyes bright & crease-free
3 PERFECT - Finish with Skin Long-Wear Weightless SPF 15 for oil-free, #fullcoverage
Available @nordstrom 
#bobbibrown #skinweek #skinlongwear #easymakeup #makeuptips #foundation #glowy #glowingskin #fallbeauty #winterbeauty
14,956 50 20 November, 2019

No more dark circles and puffy eyes. Read the caption carefully for instructions .
Instructions
First dip a cotton ball in a rose water and place in under your eyes for 15 minutes then apply aloevera gel on your under eye area and massage it gently for a minute then let it stay for half and hour then wash it off with water .
.
Follow 👉🏽 @beauty.tipss01 for more amazing tips
.
.
Tag you friends 👫👫 + someone who wants to get rid of dark circles and puffy eyes
.
.
.
#diyremedy #beautytips #beauty #puffyeyes #darkcircles #skincaretips
Attention- patch test 1st

No more dark circles and puffy eyes. Read the caption carefully for instructions .
Instructions 
First dip a cotton ball in a rose water and place in under your eyes for 15 minutes then apply aloevera gel on your under eye area and massage it gently for a minute then let it stay for half and hour then wash it off with water .
.
Follow 👉🏽 @beauty.tipss01 for more amazing tips
.
.
Tag you friends 👫👫 + someone who wants to get rid of dark circles and puffy eyes
.
.
.
#diyremedy #beautytips #beauty #puffyeyes #darkcircles #skincaretips 
Attention- patch test 1st
8,136 30 12 November, 2019

Too many events on your agenda? These ✨ holo ✨ eye masks will have you looking rested and refreshed in a jiffy! #KIKOPartyAllNight Prepping Eye Mask - Lip Gloss 02 - Lasting Mascara 24h - Define & Fix Brows 04 - Colour Lasting Creamy Eyeshadow 01 - Intense Colour Long Lasting Eyeliner 08

Too many events on your agenda? These ✨ holo ✨ eye masks will have you looking rested and refreshed in a jiffy! #KIKOPartyAllNight Prepping Eye Mask - Lip Gloss 02 - Lasting Mascara 24h - Define & Fix Brows 04 - Colour Lasting Creamy Eyeshadow 01 - Intense Colour Long Lasting Eyeliner 08
43,538 126 16 November, 2019